(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE40

ACCPU_3.PE40         Location/Qualifiers
FT   CDS             43896..44306
FT                   /locus_tag="CAP2UW1_4608"
FT                   /gene_family="HOG000124752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091545"
FT                   /db_xref="GeneID:8401980"
FT                   /translation="MARISTRKSVDVDYWRGRLEAARAFHKAAEDAITLAEPGSNANPA
FT                   ISQMVLAAIAYGDCLTARRANVINQQSHAAAPKLLRDVLGATLPTAQENRYRRILGHKD
FT                   ESQYGARSASVIHAQRLLDELQEFALWVEDQF"
FT                   /protein_id="YP_003165188.1"
     MARISTRKSV DVDYWRGRLE AARAFHKAAE DAITLAEPGS NANPAISQMV LAAIAYGDCL        60
     TARRANVINQ QSHAAAPKLL RDVLGATLPT AQENRYRRIL GHKDESQYGA RSASVIHAQR       120
     LLDELQEFAL WVEDQF                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page