(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE41

ACCPU_3.PE41         Location/Qualifiers
FT   CDS             complement(44819..45730)
FT                   /locus_tag="CAP2UW1_4610"
FT                   /gene_family="HOG000222463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091546"
FT                   /db_xref="GeneID:8402098"
FT                   /translation="MSPVPEVIKVAERLRESARAKNAGRDVSSVFQEVVQLPLWEERVR
FT                   GLPNSFARSALFTSANRSVERENFKRRKIATLRGAEIFYTGEELRQDDGDVFLQIVHLA
FT                   RQQPLGDVVEFSGYALLKDLEWTTSKGSYERLRDSINRLSSTTVLVKTDGSAGHPEKGF
FT                   GGSLVRKFEWNADAERGTSQCWRIWLEPEIVVLFGRDTYTRIDWAQRLQLPPLAKWLHQ
FT                   FYFTHEKPIGYKVETIKTLCGSRIGVLAKFRYKLREALALLVEVGFIVSYDIDSRTDIL
FT                   NVVRAPRRIAVTDVIEGKCTKH"
FT                   /protein_id="YP_003165189.1"
     MSPVPEVIKV AERLRESARA KNAGRDVSSV FQEVVQLPLW EERVRGLPNS FARSALFTSA        60
     NRSVERENFK RRKIATLRGA EIFYTGEELR QDDGDVFLQI VHLARQQPLG DVVEFSGYAL       120
     LKDLEWTTSK GSYERLRDSI NRLSSTTVLV KTDGSAGHPE KGFGGSLVRK FEWNADAERG       180
     TSQCWRIWLE PEIVVLFGRD TYTRIDWAQR LQLPPLAKWL HQFYFTHEKP IGYKVETIKT       240
     LCGSRIGVLA KFRYKLREAL ALLVEVGFIV SYDIDSRTDI LNVVRAPRRI AVTDVIEGKC       300
     TKH                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page