(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE42

ACCPU_3.PE42         Location/Qualifiers
FT   CDS             complement(46640..47599)
FT                   /locus_tag="CAP2UW1_4611"
FT                   /gene_family="HOG000229116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091547"
FT                   /db_xref="GeneID:8401982"
FT                   /translation="MAGQARKAAEAGDRFSRAEAVLDQRPTAFHQPSRDPAMVVSSKVA
FT                   AAGDKRSGRFERIPVDLIDANPYNARRIYRPQRIGELSESIVANGQMQPGIATMRDGGR
FT                   YVLVAGHYRLAAIRQAGLPTMDVMVHDGLSDRDLFEYSYRENSERDSQSALDDAMAWRE
FT                   MLDRNVYPNETALAGVVRKSLANVNRTLSILKLSGTVLDLVGQNPETFPMSCLSELVLL
FT                   EAVAGTKTALVFAEKVGQGEIGRKEIIEARMRIETPKSRKRKEISRQYKIHVSDGTQIG
FT                   ALKEWDSGRVSLDVVVSSAADRVALINELKKRFSIGDA"
FT                   /protein_id="YP_003165190.1"
     MAGQARKAAE AGDRFSRAEA VLDQRPTAFH QPSRDPAMVV SSKVAAAGDK RSGRFERIPV        60
     DLIDANPYNA RRIYRPQRIG ELSESIVANG QMQPGIATMR DGGRYVLVAG HYRLAAIRQA       120
     GLPTMDVMVH DGLSDRDLFE YSYRENSERD SQSALDDAMA WREMLDRNVY PNETALAGVV       180
     RKSLANVNRT LSILKLSGTV LDLVGQNPET FPMSCLSELV LLEAVAGTKT ALVFAEKVGQ       240
     GEIGRKEIIE ARMRIETPKS RKRKEISRQY KIHVSDGTQI GALKEWDSGR VSLDVVVSSA       300
     ADRVALINEL KKRFSIGDA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page