(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE43

ACCPU_3.PE43         Location/Qualifiers
FT   CDS             complement(47611..48318)
FT                   /locus_tag="CAP2UW1_4612"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091548"
FT                   /db_xref="GeneID:8401983"
FT                   /translation="MAKILTVFNQKGGCGKTMTAMQLAGTCAMRGYSTLVVDMDSQGTA
FT                   LVWSTVKPDPQLRLKATGFPAKVESFAPLGRGMVRPVADLAPLYDLIIIDTPPAVASEA
FT                   PWAALQISDLALIPFVPTAADMWAKEARVLARKAMEQNPDIRGVHHLPSMVRRGNTIAG
FT                   VLDQFRSDPEVALLSSTVSLLNAYLDSQMLGLCVGQLSSSSTAAKEMSALSDEVLGLLG
FT                   LSKSVEGKRKGKR"
FT                   /protein_id="YP_003165191.1"
     MAKILTVFNQ KGGCGKTMTA MQLAGTCAMR GYSTLVVDMD SQGTALVWST VKPDPQLRLK        60
     ATGFPAKVES FAPLGRGMVR PVADLAPLYD LIIIDTPPAV ASEAPWAALQ ISDLALIPFV       120
     PTAADMWAKE ARVLARKAME QNPDIRGVHH LPSMVRRGNT IAGVLDQFRS DPEVALLSST       180
     VSLLNAYLDS QMLGLCVGQL SSSSTAAKEM SALSDEVLGL LGLSKSVEGK RKGKR            235
//

If you have problems or comments...

PBIL Back to PBIL home page