(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE44

ACCPU_3.PE44         Location/Qualifiers
FT   CDS             49344..49664
FT                   /locus_tag="CAP2UW1_4613"
FT                   /gene_family="HOG000229826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091549"
FT                   /db_xref="GeneID:8401984"
FT                   /translation="MTNIIQFPKSDSSAHDLAPLKLQARPIDGPGGGRILSNLVKVVWV
FT                   ATVLMWPVMKWVLSFDVLFQFFRMLYHWSTPGVYATWTFFLHFSALVLLTCFVSLYKPR
FT                   GI"
FT                   /protein_id="YP_003165192.1"
     MTNIIQFPKS DSSAHDLAPL KLQARPIDGP GGGRILSNLV KVVWVATVLM WPVMKWVLSF        60
     DVLFQFFRML YHWSTPGVYA TWTFFLHFSA LVLLTCFVSL YKPRGI                      106
//

If you have problems or comments...

PBIL Back to PBIL home page