(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE45

ACCPU_3.PE45         Location/Qualifiers
FT   CDS             49879..50184
FT                   /locus_tag="CAP2UW1_4614"
FT                   /gene_family="HOG000113242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091550"
FT                   /db_xref="GeneID:8401985"
FT                   /translation="MKKRLTERQFQEAIKGLDVGAQTLEIARGVLIDGKPQKEFATALG
FT                   LSRGAISQAVNRVWAAHDERNLPAGYVRVSAILPEHRAFIVKKWAEDATKKRQHKK"
FT                   /protein_id="YP_003165193.1"
     MKKRLTERQF QEAIKGLDVG AQTLEIARGV LIDGKPQKEF ATALGLSRGA ISQAVNRVWA        60
     AHDERNLPAG YVRVSAILPE HRAFIVKKWA EDATKKRQHK K                           101
//

If you have problems or comments...

PBIL Back to PBIL home page