(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE46

ACCPU_3.PE46         Location/Qualifiers
FT   CDS             50189..50971
FT                   /locus_tag="CAP2UW1_4615"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091551"
FT                   /db_xref="GeneID:8401986"
FT                   /translation="MKTLVVANQKGGVGKTSTLVHLAFDFLERGLKVVVIDLDTQANAS
FT                   YTLQSFRSNLVASELFAAVPSSAWPQTATDFTDPNTQRMTLIGSDIGLANLEKKMSLAE
FT                   AGANFREAIKTVEGQGFDVCLIDTAPSLGVTMAAALLAADYVLSPIELEAYSIQGIKQM
FT                   VTTIAHLRKANHKLKFLGMVPSKVDARNPRHARHLEELERAYPQLMIPTGVGLRSSIAD
FT                   ALASRVPVWKIRKTAARKATQEIRALAAHVFEKMEMTQ"
FT                   /protein_id="YP_003165194.1"
     MKTLVVANQK GGVGKTSTLV HLAFDFLERG LKVVVIDLDT QANASYTLQS FRSNLVASEL        60
     FAAVPSSAWP QTATDFTDPN TQRMTLIGSD IGLANLEKKM SLAEAGANFR EAIKTVEGQG       120
     FDVCLIDTAP SLGVTMAAAL LAADYVLSPI ELEAYSIQGI KQMVTTIAHL RKANHKLKFL       180
     GMVPSKVDAR NPRHARHLEE LERAYPQLMI PTGVGLRSSI ADALASRVPV WKIRKTAARK       240
     ATQEIRALAA HVFEKMEMTQ                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page