(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE47

ACCPU_3.PE47         Location/Qualifiers
FT   CDS             50968..52008
FT                   /locus_tag="CAP2UW1_4616"
FT                   /gene_family="HOG000229828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091552"
FT                   /db_xref="GeneID:8401987"
FT                   /translation="MTTATHPATTAKKKPEAGPPASGLDLESIGDLSDLLNQPETVARS
FT                   FRPLELPLDLIDEDPHQPRTKDNPGFLPESLEELARTIRLRGVKTPISVRDNPDAAGRY
FT                   LINHGARRARASRLVYKTTIPAFVDNDYNEADQVIENLQRNELIPREIADFIGRELAKG
FT                   KKKGDIAKELGKSPAFVSQHVTLLDLPDPIAEAFNSGRCRDVTVINELVTAHKKARNEV
FT                   GLWLADDTQEITRGSVKLLREYLDDKRQHEDDERNSGTAESTASARAEAGAGEQATHSR
FT                   RNPKEADPDRLRRAIVHVQHDGRPARLILNRRPPVEGHAWLKYDDDGHELAADLAQVQL
FT                   VALLEG"
FT                   /protein_id="YP_003165195.1"
     MTTATHPATT AKKKPEAGPP ASGLDLESIG DLSDLLNQPE TVARSFRPLE LPLDLIDEDP        60
     HQPRTKDNPG FLPESLEELA RTIRLRGVKT PISVRDNPDA AGRYLINHGA RRARASRLVY       120
     KTTIPAFVDN DYNEADQVIE NLQRNELIPR EIADFIGREL AKGKKKGDIA KELGKSPAFV       180
     SQHVTLLDLP DPIAEAFNSG RCRDVTVINE LVTAHKKARN EVGLWLADDT QEITRGSVKL       240
     LREYLDDKRQ HEDDERNSGT AESTASARAE AGAGEQATHS RRNPKEADPD RLRRAIVHVQ       300
     HDGRPARLIL NRRPPVEGHA WLKYDDDGHE LAADLAQVQL VALLEG                      346
//

If you have problems or comments...

PBIL Back to PBIL home page