(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE48

ACCPU_3.PE48         Location/Qualifiers
FT   CDS             52165..53007
FT                   /locus_tag="CAP2UW1_4617"
FT                   /gene_family="HOG000229829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091553"
FT                   /db_xref="GeneID:8401988"
FT                   /translation="MELNKDIRDRILSAADALYEQAGRTSFPTVDSVRKVAKVNMNDAA
FT                   ATMKEWRRAQTAQAAPVAITVPEAVHQLHSQALAALWQSAQNTANESLRAAQAGWEAER
FT                   AEADTINKQLGDAYDAQGVELEAANRRIDELTAKCQHEQQRSTELVQHIEETRKATLVA
FT                   ENRAAIAEQRAVEIERRAADLRAELDLAHQDATQTRTELADLRQAQQEQRKTAAQEALR
FT                   AAERLTATQAERDESRKEAAKAREETAHWRGQVEALKEQQMGFLEAIKTGKKPSRAGE"
FT                   /protein_id="YP_003165196.1"
     MELNKDIRDR ILSAADALYE QAGRTSFPTV DSVRKVAKVN MNDAAATMKE WRRAQTAQAA        60
     PVAITVPEAV HQLHSQALAA LWQSAQNTAN ESLRAAQAGW EAERAEADTI NKQLGDAYDA       120
     QGVELEAANR RIDELTAKCQ HEQQRSTELV QHIEETRKAT LVAENRAAIA EQRAVEIERR       180
     AADLRAELDL AHQDATQTRT ELADLRQAQQ EQRKTAAQEA LRAAERLTAT QAERDESRKE       240
     AAKAREETAH WRGQVEALKE QQMGFLEAIK TGKKPSRAGE                             280
//

If you have problems or comments...

PBIL Back to PBIL home page