(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE49

ACCPU_3.PE49         Location/Qualifiers
FT   CDS             53153..53497
FT                   /locus_tag="CAP2UW1_4618"
FT                   /gene_family="HOG000229830" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091554"
FT                   /db_xref="GeneID:8401989"
FT                   /translation="MKQRLLVMNGQKIIQHEHEGRWQNDKVEKAGVVKPGIYNLYLASQ
FT                   ADKTKTHDGVILHVDRDSVFQQVGKSVVKHDRVDFVKAPAIGSQSRITYDQGKATVSVA
FT                   SHALSRGVSR"
FT                   /protein_id="YP_003165197.1"
     MKQRLLVMNG QKIIQHEHEG RWQNDKVEKA GVVKPGIYNL YLASQADKTK THDGVILHVD        60
     RDSVFQQVGK SVVKHDRVDF VKAPAIGSQS RITYDQGKAT VSVASHALSR GVSR             114
//

If you have problems or comments...

PBIL Back to PBIL home page