(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE50

ACCPU_3.PE50         Location/Qualifiers
FT   CDS             53869..55179
FT                   /locus_tag="CAP2UW1_4619"
FT                   /gene_family="HOG000059180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091555"
FT                   /db_xref="GeneID:8401990"
FT                   /translation="MLLLHISDIHFRAPECTQENDPSRAYRTRMIQDAKGRARALGGVD
FT                   AILVSGDIAFRGVQSEYAAASMWLEQLARESGCPLERIFVVPGNHDIDRSRIDGSRQIR
FT                   NIHKAIKDAAPAYRYRELQAQLTDAATGRALFEPLAAYNEFAAHFNCQVFHERLAWKQD
FT                   LDLAPGMTLRIHGFTSTLLSGAVTQDGQDDKQLSLYLSPWQTGLLDPDPNVVNLVMGHH
FT                   PPDWLMDQDEVEDAVHGRAAIHLWGHKHRQRINKDDQYIRLAAGAVNPDAGEPGWHPAY
FT                   NLIELSVQGSGPARALHVTAHLLEWQTNPERYRARQDSQGQAIFQHLIHCPGDEHPTPP
FT                   APAAPSAGPALEGVAAVAAQAPDVEAAMGETSTRHLVIRWWGLPMAARREIALRLGLIS
FT                   EDEVSLPEPERYARALLRAKERNQLEQVAEEINKWPT"
FT                   /protein_id="YP_003165198.1"
     MLLLHISDIH FRAPECTQEN DPSRAYRTRM IQDAKGRARA LGGVDAILVS GDIAFRGVQS        60
     EYAAASMWLE QLARESGCPL ERIFVVPGNH DIDRSRIDGS RQIRNIHKAI KDAAPAYRYR       120
     ELQAQLTDAA TGRALFEPLA AYNEFAAHFN CQVFHERLAW KQDLDLAPGM TLRIHGFTST       180
     LLSGAVTQDG QDDKQLSLYL SPWQTGLLDP DPNVVNLVMG HHPPDWLMDQ DEVEDAVHGR       240
     AAIHLWGHKH RQRINKDDQY IRLAAGAVNP DAGEPGWHPA YNLIELSVQG SGPARALHVT       300
     AHLLEWQTNP ERYRARQDSQ GQAIFQHLIH CPGDEHPTPP APAAPSAGPA LEGVAAVAAQ       360
     APDVEAAMGE TSTRHLVIRW WGLPMAARRE IALRLGLISE DEVSLPEPER YARALLRAKE       420
     RNQLEQVAEE INKWPT                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page