(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE51

ACCPU_3.PE51         Location/Qualifiers
FT   CDS             55167..56279
FT                   /locus_tag="CAP2UW1_4620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091556"
FT                   /db_xref="GeneID:8401991"
FT                   /translation="MADVVMKEDTEEVKPSSWFCSWTKEFQLGEGSEMLNQRWQASSNF
FT                   AYNANGADVESLVRLAVGSRHAPSPGWIATLEESFREAYPAFTASSSARELKVLSACCL
FT                   LQMCQDPDHESASLPALAITAASVSGQRKFSLPGDLPQAANEALRSQSLGVARRPKLAA
FT                   ASQYKKLFEAFEAAVQKAKAQPDVGILIEAMAQAGTTVTSVVNKTQLTLQALAKRLDQQ
FT                   DEELQMLWWLIGERSEDLACSFGDVPDAARPLVLAKELADHTLLPPGPPTVRALLSRAK
FT                   LADRGKVALVDALAAAPFEWLRSHVAPPEASPVTQPLHFAVLRQLETGPGNAWVAGWAA
FT                   TTDLPKDLSLSPLILAELFYRERLLTRLLG"
FT                   /protein_id="YP_003165199.1"
     MADVVMKEDT EEVKPSSWFC SWTKEFQLGE GSEMLNQRWQ ASSNFAYNAN GADVESLVRL        60
     AVGSRHAPSP GWIATLEESF REAYPAFTAS SSARELKVLS ACCLLQMCQD PDHESASLPA       120
     LAITAASVSG QRKFSLPGDL PQAANEALRS QSLGVARRPK LAAASQYKKL FEAFEAAVQK       180
     AKAQPDVGIL IEAMAQAGTT VTSVVNKTQL TLQALAKRLD QQDEELQMLW WLIGERSEDL       240
     ACSFGDVPDA ARPLVLAKEL ADHTLLPPGP PTVRALLSRA KLADRGKVAL VDALAAAPFE       300
     WLRSHVAPPE ASPVTQPLHF AVLRQLETGP GNAWVAGWAA TTDLPKDLSL SPLILAELFY       360
     RERLLTRLLG                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page