(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE52

ACCPU_3.PE52         Location/Qualifiers
FT   CDS             56285..57295
FT                   /locus_tag="CAP2UW1_4621"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091557"
FT                   /db_xref="GeneID:8401992"
FT                   /translation="MDDPSQVIQCSNPDCKIAETGKCVEGLDPSACGNYGKPLRVLDIA
FT                   PEAEEGAGPQMVSLPHADRLAPGEARDLLPEARARVIAIVGPHDSGKTSLIASLYDQLQ
FT                   EGPIVPFAFRGSQTLHAFEQACHDARAASQRGTPHSERTRRGEVRFFHLGLLHQESGEA
FT                   LNLLLGDRAGEEYREAGDDMTLAAEFIEVERSDVLTLLVDGKRLAQDGHRHNAREELLL
FT                   IVQALKDAEILPNGARLAIVLTKFDAVMASPNAKRVGADLATAVARLNAYFADCFAKIE
FT                   VFRVAASPTEHGVARGTGVAELLCFWLADVSPTSLPHTLQVLPERVIARLAEVGV"
FT                   /protein_id="YP_003165200.1"
     MDDPSQVIQC SNPDCKIAET GKCVEGLDPS ACGNYGKPLR VLDIAPEAEE GAGPQMVSLP        60
     HADRLAPGEA RDLLPEARAR VIAIVGPHDS GKTSLIASLY DQLQEGPIVP FAFRGSQTLH       120
     AFEQACHDAR AASQRGTPHS ERTRRGEVRF FHLGLLHQES GEALNLLLGD RAGEEYREAG       180
     DDMTLAAEFI EVERSDVLTL LVDGKRLAQD GHRHNAREEL LLIVQALKDA EILPNGARLA       240
     IVLTKFDAVM ASPNAKRVGA DLATAVARLN AYFADCFAKI EVFRVAASPT EHGVARGTGV       300
     AELLCFWLAD VSPTSLPHTL QVLPERVIAR LAEVGV                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page