(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE53

ACCPU_3.PE53         Location/Qualifiers
FT   CDS             57298..58014
FT                   /locus_tag="CAP2UW1_4622"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091558"
FT                   /db_xref="GeneID:8401993"
FT                   /translation="MMQQSVVVLGLPGSGKTTFLAALWHLVFSRETETKLRFGSLKSGN
FT                   VKHLNAIAARWRSAQMQERTLLAGNQFVSINLVTDDSQAVTITFPDIAGESYRQMWEER
FT                   ECEKVVAETLTQGSVLLFVHADDIKRPLWIMDVAAMALALDLPPDEVAQPVPWQPRLAP
FT                   TQVQLVGLLSLLGAAPLDIGPRRLVVMLSAWDKAKGERLAPREFLRAKLPLLSQYLDTN
FT                   PKLWQWTVSMAVKKRR"
FT                   /protein_id="YP_003165201.1"
     MMQQSVVVLG LPGSGKTTFL AALWHLVFSR ETETKLRFGS LKSGNVKHLN AIAARWRSAQ        60
     MQERTLLAGN QFVSINLVTD DSQAVTITFP DIAGESYRQM WEERECEKVV AETLTQGSVL       120
     LFVHADDIKR PLWIMDVAAM ALALDLPPDE VAQPVPWQPR LAPTQVQLVG LLSLLGAAPL       180
     DIGPRRLVVM LSAWDKAKGE RLAPREFLRA KLPLLSQYLD TNPKLWQWTV SMAVKKRR         238
//

If you have problems or comments...

PBIL Back to PBIL home page