(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE54

ACCPU_3.PE54         Location/Qualifiers
FT   CDS             complement(57998..58630)
FT                   /locus_tag="CAP2UW1_4623"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091559"
FT                   /db_xref="GeneID:8401994"
FT                   /translation="MRHILLTQPVTAVSFGMLEAASSALLVAAAGFLDASAACRLRAAS
FT                   GAIDLAPVAAAADDDLGSTAMAQEESAGGFHWRFRLRQRAIDRKRPLVKYSPCTRAQHG
FT                   VGHDIGVDFAGLAGVVPVLLGGSFLPHRERACHPRLAPLAASAAGFPDGHRAAGGRVSS
FT                   RPSGSFRRALLPHHRSPRRPKTPIRLDHGPSLPGHILHRSQPVIGAS"
FT                   /protein_id="YP_003165202.1"
     MRHILLTQPV TAVSFGMLEA ASSALLVAAA GFLDASAACR LRAASGAIDL APVAAAADDD        60
     LGSTAMAQEE SAGGFHWRFR LRQRAIDRKR PLVKYSPCTR AQHGVGHDIG VDFAGLAGVV       120
     PVLLGGSFLP HRERACHPRL APLAASAAGF PDGHRAAGGR VSSRPSGSFR RALLPHHRSP       180
     RRPKTPIRLD HGPSLPGHIL HRSQPVIGAS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page