(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE55

ACCPU_3.PE55         Location/Qualifiers
FT   CDS             complement(59550..61628)
FT                   /locus_tag="CAP2UW1_4625"
FT                   /gene_family="HOG000228685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091560"
FT                   /db_xref="GeneID:8402099"
FT                   /translation="MMGEQHAKIQARHLKRNAYLYVRQSTLRQVLENSESTKRQYDLRE
FT                   RALALGWRLDQVVVIDSDLGQSGASAVDREGFQRLVSEVGLGRAGIVMGLEVSRLARNS
FT                   TDWHRLLEICALADTLILDEDGVYDPAHFNDRLLLGLKGTMSEAELHVLQARLRGGILN
FT                   KARRGELEIRLPIGFDYDPAGRVRLDPDVRVQESLRQFFRTFRRTGSATATVKAFRAEG
FT                   LSFPHRIYRGPQTGELLWTDLEHSRALWLLHHPRYTGAFCFGRTRVRKQPDGSHRHQRL
FT                   PSEEWIALIRDAHAGYITWDEYEENLRILRDNAQAPATGRDRGTPREGPALLQGLALCA
FT                   KCGDRMTVRYHVNGTRRVPDYVCQREGVEHAQPICQQIVGGELDAAIGRLLVEVVTPIT
FT                   LGVALAVQKELESRSEDSDRLRRQAVERARYESDLARRRYMRCDPDNRLVADSLEVEWN
FT                   QALRNQTAAQEHYDKQRESETGLDDQQRAAILALAKDFPRLWNDPHTADRERKRMARLL
FT                   IADVTLLKEADIRAQVRFSGGATHTLHLPLPKPAWMLRQTPGTVVAEIDRLLEDHTDSE
FT                   IADWLNDQGLISGDGKPFHRPMVRRIRIDYALPSRHDRLRARGLLTLHEMAQRLNICPD
FT                   SLKRWRRAGLLKAHKYDDRGGYLFEPPGPDTPVKHQHQGKTTGKSTTREGSFPAHTA"
FT                   /protein_id="YP_003165203.1"
     MMGEQHAKIQ ARHLKRNAYL YVRQSTLRQV LENSESTKRQ YDLRERALAL GWRLDQVVVI        60
     DSDLGQSGAS AVDREGFQRL VSEVGLGRAG IVMGLEVSRL ARNSTDWHRL LEICALADTL       120
     ILDEDGVYDP AHFNDRLLLG LKGTMSEAEL HVLQARLRGG ILNKARRGEL EIRLPIGFDY       180
     DPAGRVRLDP DVRVQESLRQ FFRTFRRTGS ATATVKAFRA EGLSFPHRIY RGPQTGELLW       240
     TDLEHSRALW LLHHPRYTGA FCFGRTRVRK QPDGSHRHQR LPSEEWIALI RDAHAGYITW       300
     DEYEENLRIL RDNAQAPATG RDRGTPREGP ALLQGLALCA KCGDRMTVRY HVNGTRRVPD       360
     YVCQREGVEH AQPICQQIVG GELDAAIGRL LVEVVTPITL GVALAVQKEL ESRSEDSDRL       420
     RRQAVERARY ESDLARRRYM RCDPDNRLVA DSLEVEWNQA LRNQTAAQEH YDKQRESETG       480
     LDDQQRAAIL ALAKDFPRLW NDPHTADRER KRMARLLIAD VTLLKEADIR AQVRFSGGAT       540
     HTLHLPLPKP AWMLRQTPGT VVAEIDRLLE DHTDSEIADW LNDQGLISGD GKPFHRPMVR       600
     RIRIDYALPS RHDRLRARGL LTLHEMAQRL NICPDSLKRW RRAGLLKAHK YDDRGGYLFE       660
     PPGPDTPVKH QHQGKTTGKS TTREGSFPAH TA                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page