(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE56

ACCPU_3.PE56         Location/Qualifiers
FT   CDS             complement(61625..61909)
FT                   /locus_tag="CAP2UW1_4626"
FT                   /gene_family="HOG000158241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091561"
FT                   /db_xref="GeneID:8401996"
FT                   /translation="MKPTLMTDGQTLAEGYESLRQETAERPGGRHRSPGRALFLFKGMA
FT                   AWMRGVSETAPSPAAAALRNESRLPAGMEQHLINLVASMALATARESRP"
FT                   /protein_id="YP_003165204.1"
     MKPTLMTDGQ TLAEGYESLR QETAERPGGR HRSPGRALFL FKGMAAWMRG VSETAPSPAA        60
     AALRNESRLP AGMEQHLINL VASMALATAR ESRP                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page