(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE57

ACCPU_3.PE57         Location/Qualifiers
FT   CDS             complement(61906..62373)
FT                   /locus_tag="CAP2UW1_4627"
FT                   /gene_family="HOG000026445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091562"
FT                   /db_xref="GeneID:8401997"
FT                   /translation="MIPPSKPDPKLLALAESGTVNPHAQDVQDAAFLDSEFFDPRDLVQ
FT                   VRYEMLRRVRTEGQTVVDAASSFGVSRPTFYKAQADFERAGLAGLLPVKRGPHGPHKIT
FT                   DEVMAFIEAARAQEEGLDAQELVERIAEHFGLAVHRRTVDRALARSKKKRR"
FT                   /protein_id="YP_003165205.1"
     MIPPSKPDPK LLALAESGTV NPHAQDVQDA AFLDSEFFDP RDLVQVRYEM LRRVRTEGQT        60
     VVDAASSFGV SRPTFYKAQA DFERAGLAGL LPVKRGPHGP HKITDEVMAF IEAARAQEEG       120
     LDAQELVERI AEHFGLAVHR RTVDRALARS KKKRR                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page