(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE58

ACCPU_3.PE58         Location/Qualifiers
FT   CDS             63683..64444
FT                   /locus_tag="CAP2UW1_4629"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091563"
FT                   /db_xref="GeneID:8402100"
FT                   /translation="MIPSEALRKRAEALHLHGLLAHWSELAECVWVEPLLTWEETERAR
FT                   RSLERRLAEAHIGRFKPLADFDWDWPEQCDRTAISELMSLEFLKSASNAILVGASGLGK
FT                   STIARNIAHRAVLSGHTVLFTTAGQLLGDLAAIDSDSVLRRRLRHYAAPALLVIDEVGY
FT                   LSYSNRHADLLFELINRRHECRSTLITTNRSFSEWSEVFPNAACTVALIDRLVHHAEII
FT                   AIKGESYRRKEAQERAEQRARKRRSTVGAAA"
FT                   /protein_id="YP_003165206.1"
     MIPSEALRKR AEALHLHGLL AHWSELAECV WVEPLLTWEE TERARRSLER RLAEAHIGRF        60
     KPLADFDWDW PEQCDRTAIS ELMSLEFLKS ASNAILVGAS GLGKSTIARN IAHRAVLSGH       120
     TVLFTTAGQL LGDLAAIDSD SVLRRRLRHY AAPALLVIDE VGYLSYSNRH ADLLFELINR       180
     RHECRSTLIT TNRSFSEWSE VFPNAACTVA LIDRLVHHAE IIAIKGESYR RKEAQERAEQ       240
     RARKRRSTVG AAA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page