(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE6

ACCPU_3.PE6          Location/Qualifiers
FT   CDS             3143..7102
FT                   /locus_tag="CAP2UW1_4573"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091511"
FT                   /db_xref="GeneID:8401946"
FT                   /translation="MPHDKGLPQTGDSQEIGQDAYDCLRAKRPKGWQLTELGGVNDFGF
FT                   DLQVQISVKQQVVHPFRLQLKGTRSPLRSADGSFLSINLSTTTLRYFDNTDEPVLLVLC
FT                   DLSVDPEEPRECPLHYVWIREELDRIQIASVSLEQKEAAIRVPTANVLDRTTDLVDEVQ
FT                   KRHRLSRVGHALDTSVAGMDPSLGSEDRVVMVEAITRNIGTRSIVFAQALAEPATDVWI
FT                   NPPRGSLAWLLTEAKSAVASGEVDKCADLLRQASERFEPASAMEKAEYWHLTGRLRLVR
FT                   GDDEGASRAFKSAAETQPQAKYWAAWAESEMRRGFRNDQGQDYSDVLEALPADADPALL
FT                   GVKARLLAASRKHAEAIALLDTFEGTESLAARAVVETMFSNPDQALQACIDGIDLEEKR
FT                   ESTRLLFLILRARARFNIALRSARVEESSGEHSEDEVLPPSGPIGVDAAALREAWADIE
FT                   EAVSAMEEIRWVSNAEFVIDLWIATASMLGKQEQILARVLAAARQRPQQAELQSAAETL
FT                   AAQCGDFQAALEANSRLPDGNMKVLRRVSFLHELGKHRDCVELMAANIDTVGRSHQLFG
FT                   HVLVLAALSADVMARDPLVEAWLDILRSGDAESQAHAATLDHLLARRRNQLQSREALTD
FT                   LARVDEQLGHPKPTTLLLFEELDPGSETQAEQFLAVATRLRSMIRLSPMIAVRIGVALA
FT                   TGKRWSDLLALCEEASREFDVTGRIKAFQALALDQLGRSDEARSILESMLEGGIEDGLA
FT                   LNTYVNIMVRWGFTEKAKAAAELILERAQSKERRVECVRMLFNLEQHANPTSPRLVDLA
FT                   FRMGALASSDDEVEEGVFLCMVIAATSFETAVLSDARKEEFQARTNAFFERFPQSKILR
FT                   RVELPAEAGAEEMLRSMKSAIGVSEEREQQRARLEAQLQSGELPLPFAWRPRFALGSVQ
FT                   DVAHLWDLAKRSTVDEKKFHLNMIGEQWEQRPADSFRSRTPLFDLLTLFVLEDLELLDK
FT                   VFDFFPKVAISQETLGELMKMSQAFSGSIFRQRCIDVQDRLRPRLAQILQPHGAPSDDE
FT                   LHLPSSSRELKSLARTGNYVVYSDDAMLRMWIFEDKFAADGMCTLDLLCGLEETGLLTT
FT                   EEVATKLAQLCDWHVGIQIQLRHQLALIPETVRLAPRVLEAAAMLRGIAPFMSLARGMW
FT                   GPGTDFMGVLNHVGAVVRLLVQDPAVPDIAIGAFVAVWIDHATARADMPLPALQLAAHI
FT                   AVYAVAAGKLPIQAARRLWNVYFGVVEAVHGAPDSKAYGLALARVAQEAGALDKRMTKE
FT                   RVTPQTTIGERLMMGLDLISNAWEAFSAAYIPARK"
FT                   /protein_id="YP_003165154.1"
     MPHDKGLPQT GDSQEIGQDA YDCLRAKRPK GWQLTELGGV NDFGFDLQVQ ISVKQQVVHP        60
     FRLQLKGTRS PLRSADGSFL SINLSTTTLR YFDNTDEPVL LVLCDLSVDP EEPRECPLHY       120
     VWIREELDRI QIASVSLEQK EAAIRVPTAN VLDRTTDLVD EVQKRHRLSR VGHALDTSVA       180
     GMDPSLGSED RVVMVEAITR NIGTRSIVFA QALAEPATDV WINPPRGSLA WLLTEAKSAV       240
     ASGEVDKCAD LLRQASERFE PASAMEKAEY WHLTGRLRLV RGDDEGASRA FKSAAETQPQ       300
     AKYWAAWAES EMRRGFRNDQ GQDYSDVLEA LPADADPALL GVKARLLAAS RKHAEAIALL       360
     DTFEGTESLA ARAVVETMFS NPDQALQACI DGIDLEEKRE STRLLFLILR ARARFNIALR       420
     SARVEESSGE HSEDEVLPPS GPIGVDAAAL REAWADIEEA VSAMEEIRWV SNAEFVIDLW       480
     IATASMLGKQ EQILARVLAA ARQRPQQAEL QSAAETLAAQ CGDFQAALEA NSRLPDGNMK       540
     VLRRVSFLHE LGKHRDCVEL MAANIDTVGR SHQLFGHVLV LAALSADVMA RDPLVEAWLD       600
     ILRSGDAESQ AHAATLDHLL ARRRNQLQSR EALTDLARVD EQLGHPKPTT LLLFEELDPG       660
     SETQAEQFLA VATRLRSMIR LSPMIAVRIG VALATGKRWS DLLALCEEAS REFDVTGRIK       720
     AFQALALDQL GRSDEARSIL ESMLEGGIED GLALNTYVNI MVRWGFTEKA KAAAELILER       780
     AQSKERRVEC VRMLFNLEQH ANPTSPRLVD LAFRMGALAS SDDEVEEGVF LCMVIAATSF       840
     ETAVLSDARK EEFQARTNAF FERFPQSKIL RRVELPAEAG AEEMLRSMKS AIGVSEEREQ       900
     QRARLEAQLQ SGELPLPFAW RPRFALGSVQ DVAHLWDLAK RSTVDEKKFH LNMIGEQWEQ       960
     RPADSFRSRT PLFDLLTLFV LEDLELLDKV FDFFPKVAIS QETLGELMKM SQAFSGSIFR      1020
     QRCIDVQDRL RPRLAQILQP HGAPSDDELH LPSSSRELKS LARTGNYVVY SDDAMLRMWI      1080
     FEDKFAADGM CTLDLLCGLE ETGLLTTEEV ATKLAQLCDW HVGIQIQLRH QLALIPETVR      1140
     LAPRVLEAAA MLRGIAPFMS LARGMWGPGT DFMGVLNHVG AVVRLLVQDP AVPDIAIGAF      1200
     VAVWIDHATA RADMPLPALQ LAAHIAVYAV AAGKLPIQAA RRLWNVYFGV VEAVHGAPDS      1260
     KAYGLALARV AQEAGALDKR MTKERVTPQT TIGERLMMGL DLISNAWEAF SAAYIPARK       1319
//

If you have problems or comments...

PBIL Back to PBIL home page