(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE60

ACCPU_3.PE60         Location/Qualifiers
FT   CDS             64988..67078
FT                   /locus_tag="CAP2UW1_4631"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091565"
FT                   /db_xref="GeneID:8402000"
FT                   /translation="MAQQQIVIRQAVHGYVEGHRELWSSAQLKQRDSKTVLIYSDTSSS
FT                   GLPIGEGGYLTGYPLPESGYYAFARTWPAPEMQRPGAVWTHTLFIEFADVARLRDATAL
FT                   LRLFRRPEGMQGSKSESTREEALELSVTESEPLDFATESDEIWYRQLLVALYGSPDAKV
FT                   VAVCGSDDAARIERNVLTLWSQQWPRLRRAMRFCTLTTADRSAPKSAFDLQVVPDSERG
FT                   MRSKFPSTTFAQDTAVVAADWLDHLVLDSKSPGVTGLRDFLQQAGADLTTGRRAFVPLT
FT                   RLHMALTNRTSGRDRWNDALSLVSEVSSGEPSTAAQLVLTAAISSASDLDAPSLDFVLN
FT                   NLALVDQQQLVANARALGVAVWRLSPLRLAQLWESGGPGRDVASSGLNAIDLDLLLEGL
FT                   PLTGEFADTAFKLRPDLLTSAAIWRADPVLATRAIRAAASNVEIAPRSLDQLIASQSSA
FT                   LIPTAFEAFGNENVWRHLATALTSREQHAPALPDWLQSGMKYPETVAQVLASTHGLDRS
FT                   ALAAIARASHPDLVPNDFGDDPWVIAVQPTDADAIPDDDVYLCSYLLARAFGPRSRRIA
FT                   ELVELALNTVSSAAASNVLTQSAWQLLAPRFPESHDWQSWDRYQRLLAGVGQLYVRKNL
FT                   AVDSFGRLGRDTSDFNCIVSAAAKEWDGRGYLRGVRREFKNSHDFSSQRRRIIEDAIGS
FT                   WF"
FT                   /protein_id="YP_003165208.1"
     MAQQQIVIRQ AVHGYVEGHR ELWSSAQLKQ RDSKTVLIYS DTSSSGLPIG EGGYLTGYPL        60
     PESGYYAFAR TWPAPEMQRP GAVWTHTLFI EFADVARLRD ATALLRLFRR PEGMQGSKSE       120
     STREEALELS VTESEPLDFA TESDEIWYRQ LLVALYGSPD AKVVAVCGSD DAARIERNVL       180
     TLWSQQWPRL RRAMRFCTLT TADRSAPKSA FDLQVVPDSE RGMRSKFPST TFAQDTAVVA       240
     ADWLDHLVLD SKSPGVTGLR DFLQQAGADL TTGRRAFVPL TRLHMALTNR TSGRDRWNDA       300
     LSLVSEVSSG EPSTAAQLVL TAAISSASDL DAPSLDFVLN NLALVDQQQL VANARALGVA       360
     VWRLSPLRLA QLWESGGPGR DVASSGLNAI DLDLLLEGLP LTGEFADTAF KLRPDLLTSA       420
     AIWRADPVLA TRAIRAAASN VEIAPRSLDQ LIASQSSALI PTAFEAFGNE NVWRHLATAL       480
     TSREQHAPAL PDWLQSGMKY PETVAQVLAS THGLDRSALA AIARASHPDL VPNDFGDDPW       540
     VIAVQPTDAD AIPDDDVYLC SYLLARAFGP RSRRIAELVE LALNTVSSAA ASNVLTQSAW       600
     QLLAPRFPES HDWQSWDRYQ RLLAGVGQLY VRKNLAVDSF GRLGRDTSDF NCIVSAAAKE       660
     WDGRGYLRGV RREFKNSHDF SSQRRRIIED AIGSWF                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page