(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE61

ACCPU_3.PE61         Location/Qualifiers
FT   CDS             complement(67668..68600)
FT                   /locus_tag="CAP2UW1_4632"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091566"
FT                   /db_xref="GeneID:8402001"
FT                   /translation="MTLPAHKTTDGAAAARYAAGLLGVATCAETTATTMAEDAGKVDVK
FT                   FSFRHIVATGKLITAHAQVKAGPSYRRDSSNTQFLTLRIDKATLQALSGTGMPGLVIWV
FT                   PPPPMDRLYWYATDPRRPLRTPAKVRRTQYLRPSLRYDLSRLYDYASWSRRYTKQTVAA
FT                   LSSAQVMPRAKEAYKALKAQQWHNPLVGPLQITRFAWRHITRRSKSVARRTMSLRILPY
FT                   LKAFLASPPDRYTSNFVGLKANGSITTETRYLMCWYRQALTVDGESHSLLVRIREEITY
FT                   PTEWAKRPLSDTEVQQVATLAAWWCKRDK"
FT                   /protein_id="YP_003165209.1"
     MTLPAHKTTD GAAAARYAAG LLGVATCAET TATTMAEDAG KVDVKFSFRH IVATGKLITA        60
     HAQVKAGPSY RRDSSNTQFL TLRIDKATLQ ALSGTGMPGL VIWVPPPPMD RLYWYATDPR       120
     RPLRTPAKVR RTQYLRPSLR YDLSRLYDYA SWSRRYTKQT VAALSSAQVM PRAKEAYKAL       180
     KAQQWHNPLV GPLQITRFAW RHITRRSKSV ARRTMSLRIL PYLKAFLASP PDRYTSNFVG       240
     LKANGSITTE TRYLMCWYRQ ALTVDGESHS LLVRIREEIT YPTEWAKRPL SDTEVQQVAT       300
     LAAWWCKRDK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page