(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE62

ACCPU_3.PE62         Location/Qualifiers
FT   CDS             complement(68700..68837)
FT                   /locus_tag="CAP2UW1_4633"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091567"
FT                   /db_xref="GeneID:8402002"
FT                   /translation="MVKQSNQGSHFEAVWVYAIHLAWETLLFTIPLYSTEFPWIRREAF
FT                   "
FT                   /protein_id="YP_003165210.1"
     MVKQSNQGSH FEAVWVYAIH LAWETLLFTI PLYSTEFPWI RREAF                        45
//

If you have problems or comments...

PBIL Back to PBIL home page