(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE63

ACCPU_3.PE63         Location/Qualifiers
FT   CDS             complement(69238..70026)
FT                   /locus_tag="CAP2UW1_4634"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091568"
FT                   /db_xref="GeneID:8402003"
FT                   /translation="MNPVPQLEPLLKQLRLSGILDSLDARNRQAIEAKLAYTDFLALLV
FT                   QDEIARRDQRQFAQRLRKAQVIGDKTLERFDYTHSPSVNHALIAELATCRFVTEHSSVL
FT                   IAGPTGTGKSHLVQSLCHCALRAGHEVLFISHTKLLAQLQAARATDTFERKLRQLARID
FT                   VLAIDDFGLRPMRSPQDEDFHDLIDARYERTTSLLTSNLHFDEWGAAFPNKLMGAATLD
FT                   RLRDGAYRIVLDGETRRKPRPMPESTSAARIPPATLQAAR"
FT                   /protein_id="YP_003165211.1"
     MNPVPQLEPL LKQLRLSGIL DSLDARNRQA IEAKLAYTDF LALLVQDEIA RRDQRQFAQR        60
     LRKAQVIGDK TLERFDYTHS PSVNHALIAE LATCRFVTEH SSVLIAGPTG TGKSHLVQSL       120
     CHCALRAGHE VLFISHTKLL AQLQAARATD TFERKLRQLA RIDVLAIDDF GLRPMRSPQD       180
     EDFHDLIDAR YERTTSLLTS NLHFDEWGAA FPNKLMGAAT LDRLRDGAYR IVLDGETRRK       240
     PRPMPESTSA ARIPPATLQA AR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page