(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE64

ACCPU_3.PE64         Location/Qualifiers
FT   CDS             complement(70081..71619)
FT                   /locus_tag="CAP2UW1_4635"
FT                   /gene_family="HOG000023904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091569"
FT                   /db_xref="GeneID:8402004"
FT                   /translation="MYEIRQIIQRLRLGESNRAVARSQGVGRDTVAQLRNLAASQNWLD
FT                   ATGPMPDDATIALHYRSTGKGATEGPIKNPSHVSTVEPFREDVLAWHRQGIQVSSIRQA
FT                   LARQHGYDGSVHALYRFIRREAPDAPVATVMLDFAVGEQAQVDFGSGPLITDRHSDEVF
FT                   KTWFFVMTLAWSRHQYAELVRNQSVETWLACHRHAFEWFNGVPRKVRIDNPKCAITRAC
FT                   YYEPTVQRAYGELALGYTFVIDPCPVADPAKKGRVEAGVKYVKRNFMPLREFHSLAHAN
FT                   EQLQTWVRDEAGNRIHGSTRERPLKRFNETEQALLQPLPAIAPACPTWAKAKLHGNCHV
FT                   QHEYCQYSAPFRLIHQTLWLEITPDALRIYQEHELVAIHPRLFKRGDHSTVQDHLPPHA
FT                   QAYFMRDPQWCLAQAMTIGPACLAVVESLFANRVLDHLRAAQGLLRLGDQFGRGRLDAA
FT                   CSRALNFGTPSYRTIKQILNTGLDQQPELIESPALDAPYLDGGRFSRSPNDSLH"
FT                   /protein_id="YP_003165212.1"
     MYEIRQIIQR LRLGESNRAV ARSQGVGRDT VAQLRNLAAS QNWLDATGPM PDDATIALHY        60
     RSTGKGATEG PIKNPSHVST VEPFREDVLA WHRQGIQVSS IRQALARQHG YDGSVHALYR       120
     FIRREAPDAP VATVMLDFAV GEQAQVDFGS GPLITDRHSD EVFKTWFFVM TLAWSRHQYA       180
     ELVRNQSVET WLACHRHAFE WFNGVPRKVR IDNPKCAITR ACYYEPTVQR AYGELALGYT       240
     FVIDPCPVAD PAKKGRVEAG VKYVKRNFMP LREFHSLAHA NEQLQTWVRD EAGNRIHGST       300
     RERPLKRFNE TEQALLQPLP AIAPACPTWA KAKLHGNCHV QHEYCQYSAP FRLIHQTLWL       360
     EITPDALRIY QEHELVAIHP RLFKRGDHST VQDHLPPHAQ AYFMRDPQWC LAQAMTIGPA       420
     CLAVVESLFA NRVLDHLRAA QGLLRLGDQF GRGRLDAACS RALNFGTPSY RTIKQILNTG       480
     LDQQPELIES PALDAPYLDG GRFSRSPNDS LH                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page