(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE65

ACCPU_3.PE65         Location/Qualifiers
FT   CDS             complement(72100..72537)
FT                   /locus_tag="CAP2UW1_4636"
FT                   /gene_family="HOG000229832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TraM"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091570"
FT                   /db_xref="GeneID:8402005"
FT                   /translation="MADPVEELIKEIAAKHGIAVSRDDPILILQTINTRLLQDSAKAQQ
FT                   VMLDQYKEELEALALRWGNDARDKAERILNASLTASKGAMVMVMQEGAREAAGVVRGEV
FT                   DAALGRVRGAMRDARRVAALNVVASCITCLAAAVALWAAVH"
FT                   /protein_id="YP_003165213.1"
     MADPVEELIK EIAAKHGIAV SRDDPILILQ TINTRLLQDS AKAQQVMLDQ YKEELEALAL        60
     RWGNDARDKA ERILNASLTA SKGAMVMVMQ EGAREAAGVV RGEVDAALGR VRGAMRDARR       120
     VAALNVVASC ITCLAAAVAL WAAVH                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page