(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE66

ACCPU_3.PE66         Location/Qualifiers
FT   CDS             complement(72537..73262)
FT                   /locus_tag="CAP2UW1_4637"
FT                   /gene_family="HOG000229833" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TraL"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091571"
FT                   /db_xref="GeneID:8402006"
FT                   /translation="MAKIHMVLQGKGGVGKSFIATVIAQYKISKGQQPLCIDTDPVNAT
FT                   FHGFKALNVRLLEIMQGDEIQTRNFDTLVELIAPSKDDVIIDNGASSFVPLTHYLISNQ
FT                   VPALLQEMGHEMVVHTVITGSQALLDTVSGFAQLASQFPAEALFVVWLNPFWGSIEHEG
FT                   KGFEQMKAYTANKARVSAIVTIPALKEDTYGRDLSDMLLERLTFDEALAMDSLTIMTRQ
FT                   RLKIVKGQLFSQLDSAAVL"
FT                   /protein_id="YP_003165214.1"
     MAKIHMVLQG KGGVGKSFIA TVIAQYKISK GQQPLCIDTD PVNATFHGFK ALNVRLLEIM        60
     QGDEIQTRNF DTLVELIAPS KDDVIIDNGA SSFVPLTHYL ISNQVPALLQ EMGHEMVVHT       120
     VITGSQALLD TVSGFAQLAS QFPAEALFVV WLNPFWGSIE HEGKGFEQMK AYTANKARVS       180
     AIVTIPALKE DTYGRDLSDM LLERLTFDEA LAMDSLTIMT RQRLKIVKGQ LFSQLDSAAV       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page