(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE67

ACCPU_3.PE67         Location/Qualifiers
FT   CDS             complement(73262..73660)
FT                   /locus_tag="CAP2UW1_4638"
FT                   /gene_family="HOG000229834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091572"
FT                   /db_xref="GeneID:8402007"
FT                   /translation="MAKSLSARIAERIARKKPAGNVRNRAAFLALRGEVKQAIDDGWPV
FT                   KTIWETLHDEEKVAFSYQAFRGYVNRLILSPPADGQAAPVPVVADQPRQVASRLAPQSA
FT                   TNPAERKAEKPTATGFTFNRTPKKEDLL"
FT                   /protein_id="YP_003165215.1"
     MAKSLSARIA ERIARKKPAG NVRNRAAFLA LRGEVKQAID DGWPVKTIWE TLHDEEKVAF        60
     SYQAFRGYVN RLILSPPADG QAAPVPVVAD QPRQVASRLA PQSATNPAER KAEKPTATGF       120
     TFNRTPKKED LL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page