(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE7

ACCPU_3.PE7          Location/Qualifiers
FT   CDS             complement(7542..8204)
FT                   /locus_tag="CAP2UW1_4574"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091512"
FT                   /db_xref="GeneID:8401947"
FT                   /translation="MGVSVVTGANRGIGLELAQQLKARGASVVAVCRKGSPELDALGVR
FT                   VESQINLTERLAWSKIAERLAHDEIDLLIHNAGVLMADSLEEVDPDEVRAQFEVNAVAP
FT                   LFLTRALASRLHPGSKVALITSRMGSMGDNTSGGYYGYRMSKAALNAAGVSLAHDLKPR
FT                   GVAVVILHPGFVRTAMTRGHGQIDPDESVRGLLQRIDELKIETTGRFLHQNGDILPW"
FT                   /protein_id="YP_003165155.1"
     MGVSVVTGAN RGIGLELAQQ LKARGASVVA VCRKGSPELD ALGVRVESQI NLTERLAWSK        60
     IAERLAHDEI DLLIHNAGVL MADSLEEVDP DEVRAQFEVN AVAPLFLTRA LASRLHPGSK       120
     VALITSRMGS MGDNTSGGYY GYRMSKAALN AAGVSLAHDL KPRGVAVVIL HPGFVRTAMT       180
     RGHGQIDPDE SVRGLLQRID ELKIETTGRF LHQNGDILPW                             220
//

If you have problems or comments...

PBIL Back to PBIL home page