(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE70

ACCPU_3.PE70         Location/Qualifiers
FT   CDS             76633..78543
FT                   /locus_tag="CAP2UW1_4641"
FT                   /gene_family="HOG000289392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer coupling protein TraG"
FT                   /transl_table="11"
FT                   /note="type IV secretion system VirD4 family"
FT                   /db_xref="GI:257091575"
FT                   /db_xref="GeneID:8402010"
FT                   /translation="MKDQFNNAVGPQVRGSTPKAGKLIPALVVVSLAAGLQSATQFFAH
FT                   DFGYQAALGRHFEHLYVPWSILQWAGQWYGQYPEAIMRAGSVGMIVTTLGLLGLAVSRM
FT                   VLANSSRLNPYLHGSARWANLKDIQASGLLPRPRTFWQALTGARPAASAGVYVGAWLDP
FT                   RGHSHYLRHNGPEHVLCYAPTRSGKGVGLVVPTLLSWGESAVITDLKGELWALTAGWRR
FT                   QHAKNQVLRFEPAAASGSVCWNPLDEIRIGTEHEVGDVQNLATLIVDPDGRGLESHWQK
FT                   TSQALLVGVILHALYKAANEGTAATLPAVDALLADPDRDVAELWMEMRTYGHLDGQNHP
FT                   AVGSAARDMMDRPDEEAGSVLSTAKSYLAVYRDPVVARNVSKSEFRIRDLMHHAQPVSL
FT                   YILTQPNDKTRLRPLVRVMVSMIVHLLADKLHFENGRPVAHYRHRLLMMLDEFPSLGKL
FT                   EILQESLAFVAGYGIKCYLVCQDINQLKSRETGYGHDESITSNCHVQNAYPPNRVETAE
FT                   HLSKLTGQTTVAKEQITTSGRRASALLGQVSRTIQEVQRPLLTPDECLRMPGPIKNAHG
FT                   DIEEAGDMVVYVAGYPAIYGKQPLYFKDPIFQARAAIPAPQDSDKLIHVHDVPAGEGIT
FT                   L"
FT                   /protein_id="YP_003165218.1"
     MKDQFNNAVG PQVRGSTPKA GKLIPALVVV SLAAGLQSAT QFFAHDFGYQ AALGRHFEHL        60
     YVPWSILQWA GQWYGQYPEA IMRAGSVGMI VTTLGLLGLA VSRMVLANSS RLNPYLHGSA       120
     RWANLKDIQA SGLLPRPRTF WQALTGARPA ASAGVYVGAW LDPRGHSHYL RHNGPEHVLC       180
     YAPTRSGKGV GLVVPTLLSW GESAVITDLK GELWALTAGW RRQHAKNQVL RFEPAAASGS       240
     VCWNPLDEIR IGTEHEVGDV QNLATLIVDP DGRGLESHWQ KTSQALLVGV ILHALYKAAN       300
     EGTAATLPAV DALLADPDRD VAELWMEMRT YGHLDGQNHP AVGSAARDMM DRPDEEAGSV       360
     LSTAKSYLAV YRDPVVARNV SKSEFRIRDL MHHAQPVSLY ILTQPNDKTR LRPLVRVMVS       420
     MIVHLLADKL HFENGRPVAH YRHRLLMMLD EFPSLGKLEI LQESLAFVAG YGIKCYLVCQ       480
     DINQLKSRET GYGHDESITS NCHVQNAYPP NRVETAEHLS KLTGQTTVAK EQITTSGRRA       540
     SALLGQVSRT IQEVQRPLLT PDECLRMPGP IKNAHGDIEE AGDMVVYVAG YPAIYGKQPL       600
     YFKDPIFQAR AAIPAPQDSD KLIHVHDVPA GEGITL                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page