(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE72

ACCPU_3.PE72         Location/Qualifiers
FT   CDS             79120..79407
FT                   /locus_tag="CAP2UW1_4643"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091577"
FT                   /db_xref="GeneID:8402012"
FT                   /translation="MNDPNTLPKNDVTFAERADDQANAADDQPNAADALREKLLDAMTP
FT                   GYQAEFDPDEAEKAGAFIEDALSEQDAAESDIDLVDTTAAVATTTTKARR"
FT                   /protein_id="YP_003165220.1"
     MNDPNTLPKN DVTFAERADD QANAADDQPN AADALREKLL DAMTPGYQAE FDPDEAEKAG        60
     AFIEDALSEQ DAAESDIDLV DTTAAVATTT TKARR                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page