(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE73

ACCPU_3.PE73         Location/Qualifiers
FT   CDS             79413..82124
FT                   /locus_tag="CAP2UW1_4644"
FT                   /gene_family="HOG000229807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091578"
FT                   /db_xref="GeneID:8402013"
FT                   /translation="MADTKKAFHEQVAEKLIEQLRQGTAPWQRPWEAGEAASLLPINPT
FT                   TGKRYRGINAIQLLSQGRVDRRWLTYKQAAAAGAQVRKGEHGTAIQYWKFSEEQTRTDE
FT                   SGKPVLDAQGQPVKAEVRLERPRVFFATVFNAEQIDGLPAMQRREQTWDAVERAEAILQ
FT                   ASRAVIQHGGQNRAFYRLRTDSIHLPDKGQFPSADNYYAIALHELGHWTGHPSRLDRDL
FT                   AHPFGSEGYAKEELRAEIASMILGDELGIGHDPGQHAAYVGTWINVLRDDPLEIFRAAA
FT                   DAEKIHGYVLALEQQQVQEQTSQQAQTQDSAQNQGSAENHDNTENQEAAMKSFTQTPVL
FT                   ASAALNSTDGEAAVADPRLDPINPHEQAARLARIEEERVRRDPNSTDEDIAAAREARKS
FT                   ADVAALLNDKDLQRQIAEHEREQQTTQAGQVDQASQSSKIWIDVPYPQKDEAKALGARW
FT                   DRQEQSWYVPAGVDPAPFARWTPAAAPQARPKQSPATPPRQYLAVPYGERVAAKAAGAV
FT                   WDKAAKSWYAGPKADLAKLKRWKPENVPTQQGPAMTPRDEFAEALRSIGCVVSGDHPIM
FT                   DGQKHRISVEGEKHSEKSGSGFYVGHLDGHPAGYMKNNKIGIDLKWKSKGYTFEPEQKA
FT                   RMLAEAAEKLQARTAEQERLHEQTAQRVARQMAKLLPVIEPTAYMNAKGIEPQPGVFTD
FT                   REGQKTYIPATDVDGKQWTMQYIREDGSKRFAKDSRKEVCFHAIGGLDALAKAPVLVIG
FT                   EGYATAGSLSQTLGFATVAAFDSGNLVPVAKALHEKYPDKPIVIAGDDDKHLEATQGVN
FT                   PGRSKAEEAARAVGGKLLLPIFAPGEQAANPKGFTDFNDLATKSVLGQEGIARQVRSVV
FT                   DDVIEWQRGRSVEGRARGERQEQAVRRVAKVG"
FT                   /protein_id="YP_003165221.1"
     MADTKKAFHE QVAEKLIEQL RQGTAPWQRP WEAGEAASLL PINPTTGKRY RGINAIQLLS        60
     QGRVDRRWLT YKQAAAAGAQ VRKGEHGTAI QYWKFSEEQT RTDESGKPVL DAQGQPVKAE       120
     VRLERPRVFF ATVFNAEQID GLPAMQRREQ TWDAVERAEA ILQASRAVIQ HGGQNRAFYR       180
     LRTDSIHLPD KGQFPSADNY YAIALHELGH WTGHPSRLDR DLAHPFGSEG YAKEELRAEI       240
     ASMILGDELG IGHDPGQHAA YVGTWINVLR DDPLEIFRAA ADAEKIHGYV LALEQQQVQE       300
     QTSQQAQTQD SAQNQGSAEN HDNTENQEAA MKSFTQTPVL ASAALNSTDG EAAVADPRLD       360
     PINPHEQAAR LARIEEERVR RDPNSTDEDI AAAREARKSA DVAALLNDKD LQRQIAEHER       420
     EQQTTQAGQV DQASQSSKIW IDVPYPQKDE AKALGARWDR QEQSWYVPAG VDPAPFARWT       480
     PAAAPQARPK QSPATPPRQY LAVPYGERVA AKAAGAVWDK AAKSWYAGPK ADLAKLKRWK       540
     PENVPTQQGP AMTPRDEFAE ALRSIGCVVS GDHPIMDGQK HRISVEGEKH SEKSGSGFYV       600
     GHLDGHPAGY MKNNKIGIDL KWKSKGYTFE PEQKARMLAE AAEKLQARTA EQERLHEQTA       660
     QRVARQMAKL LPVIEPTAYM NAKGIEPQPG VFTDREGQKT YIPATDVDGK QWTMQYIRED       720
     GSKRFAKDSR KEVCFHAIGG LDALAKAPVL VIGEGYATAG SLSQTLGFAT VAAFDSGNLV       780
     PVAKALHEKY PDKPIVIAGD DDKHLEATQG VNPGRSKAEE AARAVGGKLL LPIFAPGEQA       840
     ANPKGFTDFN DLATKSVLGQ EGIARQVRSV VDDVIEWQRG RSVEGRARGE RQEQAVRRVA       900
     KVG                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page