(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE74

ACCPU_3.PE74         Location/Qualifiers
FT   CDS             83943..84335
FT                   /locus_tag="CAP2UW1_4646"
FT                   /gene_family="HOG000110426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091579"
FT                   /db_xref="GeneID:8402101"
FT                   /translation="MKTNFSKLALIAAIGLAAAGTSYAHEDYSEARIDHWLRHVSESQS
FT                   APTANQLAPFGYAATKNADREVSLPSGGKYLNVTRLETLKLNVDGKSVVWTFDTLGTAA
FT                   FPLSTIVPGADGITVYVRENPAYQGG"
FT                   /protein_id="YP_003165222.1"
     MKTNFSKLAL IAAIGLAAAG TSYAHEDYSE ARIDHWLRHV SESQSAPTAN QLAPFGYAAT        60
     KNADREVSLP SGGKYLNVTR LETLKLNVDG KSVVWTFDTL GTAAFPLSTI VPGADGITVY       120
     VRENPAYQGG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page