(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE76

ACCPU_3.PE76         Location/Qualifiers
FT   CDS             complement(84738..86045)
FT                   /locus_tag="CAP2UW1_4648"
FT                   /gene_family="HOG000224357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091581"
FT                   /db_xref="GeneID:8402016"
FT                   /translation="MKTIELPETPRQLHHLLARRLGIGALLVGSLAGGLAYWVESYRVE
FT                   QRTLERAITGVRHFESPAMQLAVGGEKGDGHSAISQLLTDEFVGIRVFASNAEMLFDVW
FT                   RPLPETLKEFARQQRHPWPIPPNSHSKRIPVAGEELVQVILPMTTNDGRLVGYVEGISL
FT                   VSQSALHERKLQTRGAALTATISVLAAALLLYPLMSGLLGRTVALSSRLLDANLSLLRS
FT                   LGNAIAKRDADTDAHNYRVTCYAVTLAEAVGVDKETVTELVLGAFLHDVGKIGIPNQIL
FT                   LKPGRLTSEEFQVMQTHAVLGIEIVAGNPWLSGAEKTIRHHHERFDGKGYPDGLSGKAI
FT                   PLAARIFALVDVFDALTSVRPYKPALSLDETLSIMEREAGQHFDPAIYAVFRQIAPMLY
FT                   EQGQSRDHTQWILELKVMLERCFKMKTAPEGAVEFA"
FT                   /protein_id="YP_003165224.1"
     MKTIELPETP RQLHHLLARR LGIGALLVGS LAGGLAYWVE SYRVEQRTLE RAITGVRHFE        60
     SPAMQLAVGG EKGDGHSAIS QLLTDEFVGI RVFASNAEML FDVWRPLPET LKEFARQQRH       120
     PWPIPPNSHS KRIPVAGEEL VQVILPMTTN DGRLVGYVEG ISLVSQSALH ERKLQTRGAA       180
     LTATISVLAA ALLLYPLMSG LLGRTVALSS RLLDANLSLL RSLGNAIAKR DADTDAHNYR       240
     VTCYAVTLAE AVGVDKETVT ELVLGAFLHD VGKIGIPNQI LLKPGRLTSE EFQVMQTHAV       300
     LGIEIVAGNP WLSGAEKTIR HHHERFDGKG YPDGLSGKAI PLAARIFALV DVFDALTSVR       360
     PYKPALSLDE TLSIMEREAG QHFDPAIYAV FRQIAPMLYE QGQSRDHTQW ILELKVMLER       420
     CFKMKTAPEG AVEFA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page