(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE77

ACCPU_3.PE77         Location/Qualifiers
FT   CDS             complement(86042..86401)
FT                   /locus_tag="CAP2UW1_4649"
FT                   /gene_family="HOG000257191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091582"
FT                   /db_xref="GeneID:8402017"
FT                   /translation="MLGVRAYRQQLLASNIANADTPGYKAVDIDINEAARVVTSTAASL
FT                   SLATTANGHLSGGTQAPPFPLKFHVPYQAAADGNTVEMDVERQKFSENSLMYQFSLDRV
FT                   SGHFKHLMELLQNLK"
FT                   /protein_id="YP_003165225.1"
     MLGVRAYRQQ LLASNIANAD TPGYKAVDID INEAARVVTS TAASLSLATT ANGHLSGGTQ        60
     APPFPLKFHV PYQAAADGNT VEMDVERQKF SENSLMYQFS LDRVSGHFKH LMELLQNLK        119
//

If you have problems or comments...

PBIL Back to PBIL home page