(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE8

ACCPU_3.PE8          Location/Qualifiers
FT   CDS             complement(8262..8783)
FT                   /locus_tag="CAP2UW1_4575"
FT                   /gene_family="HOG000118593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091513"
FT                   /db_xref="GeneID:8401948"
FT                   /translation="MSAPATPHRIEPLGKGHDRDSFCCGSAPLDRYLRQQARQDADKRV
FT                   AAPFVLIEPPAAQVLGYYTLSASTVDASELPDALTKKLPRYPQLPVTLLGRLAVDQSMK
FT                   GMGMGEFLLMDALRRSVEAAANIAAMAVLVDAKDEAAEAFYRHFSFLPLQQRPARLYLS
FT                   MKTIIALFGD"
FT                   /protein_id="YP_003165156.1"
     MSAPATPHRI EPLGKGHDRD SFCCGSAPLD RYLRQQARQD ADKRVAAPFV LIEPPAAQVL        60
     GYYTLSASTV DASELPDALT KKLPRYPQLP VTLLGRLAVD QSMKGMGMGE FLLMDALRRS       120
     VEAAANIAAM AVLVDAKDEA AEAFYRHFSF LPLQQRPARL YLSMKTIIAL FGD              173
//

If you have problems or comments...

PBIL Back to PBIL home page