(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE80

ACCPU_3.PE80         Location/Qualifiers
FT   CDS             complement(90397..93531)
FT                   /locus_tag="CAP2UW1_4654"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091585"
FT                   /db_xref="GeneID:8402103"
FT                   /translation="MLANIIGWSGRNRFLVLFATLFITIAGIYAVLRTPIDALPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLTTAMLSVPKSKVVRGFSFFGASFVYIIFEDGTDIY
FT                   WARSRVLEYLNFASSRMPKGVTPSLGPDATGVGWVYQYALLAKDKTLAELRTIQDWYVR
FT                   YQLTKAHGVAEVASIGGFVQTYQVTVDPVKLRSYGIPLMKVAQVIRDSNRDVGGRVVEM
FT                   AETEYMVRGKGYLRGKSDLEMLVVKSDKGTPVLIRDIARVELVPDERRGLTELNGEGEV
FT                   VSGIAMARYGANALEVIHNLKAKIDEIGGGLPAGVTVETVYDRSELIHRAIDTLKRTLI
FT                   EEAVIVALVCIVFLMHVRSALVAILMLPVGVLIAFIAMRSLGLNSNLMSLGGIAIAIGA
FT                   MIDAAIVMIENAHKHLERLPEGHTTAERADAMLAACKEVGPALFFSLLIITVSFLPVFA
FT                   LEGQEGRLFSPLAYTKTFSMAGAALLSVTLVPVLMMLFIRGKIMPEAKNPVNRFLIWVY
FT                   RPIIAGIMRWKKTTIVAAVVALVASIYPASQLGSEFMPTLNEGSLLYMPASLPGMSITK
FT                   AAELLQTQNKIIKSFPEVTSVYGKAGRANTATDPAPTEMFETVINLKPESEWRPGLTTD
FT                   KLIAELDKALQFPGVANSWTMPIKARIDMLSTGIRTPIGIKVFGKDLGEMEKVAREIEA
FT                   VVKAVPGTTSAYAERITGGFYLNIEPDREQLARYGLAVGDLQDVIGTALGGEMVTTTVE
FT                   GRERFGVSVRYPRELRSDPQQIAREVLIPTMDGAMIPLGQLARVGVAKGAPSIRTENAL
FT                   LSAYIFVDIRDRDIGSYVADAKKAVAEQVSFPPGYYVTWSGQFEYMERAIEKMKIVIPV
FT                   TLLSIFLLLYLNFKRLTETLIVMLSVPFALVGGVWLMWWLGYNLSVAVAVGFIALAGVA
FT                   AETGVIMLIYLDHAWEALKAKRRTDNQAPTLHDLYEAIMEGAVERVRPKMMTVVAIMAG
FT                   LLPIMWGTGTGSEVMSRIAAPMVGGMISSTVLTLAVIPAIYALVKQWRIKRGMEQ"
FT                   /protein_id="YP_003165228.1"
     MLANIIGWSG RNRFLVLFAT LFITIAGIYA VLRTPIDALP DLSDVQVIVY TEYPGQAPQV        60
     VEDQVTYPLT TAMLSVPKSK VVRGFSFFGA SFVYIIFEDG TDIYWARSRV LEYLNFASSR       120
     MPKGVTPSLG PDATGVGWVY QYALLAKDKT LAELRTIQDW YVRYQLTKAH GVAEVASIGG       180
     FVQTYQVTVD PVKLRSYGIP LMKVAQVIRD SNRDVGGRVV EMAETEYMVR GKGYLRGKSD       240
     LEMLVVKSDK GTPVLIRDIA RVELVPDERR GLTELNGEGE VVSGIAMARY GANALEVIHN       300
     LKAKIDEIGG GLPAGVTVET VYDRSELIHR AIDTLKRTLI EEAVIVALVC IVFLMHVRSA       360
     LVAILMLPVG VLIAFIAMRS LGLNSNLMSL GGIAIAIGAM IDAAIVMIEN AHKHLERLPE       420
     GHTTAERADA MLAACKEVGP ALFFSLLIIT VSFLPVFALE GQEGRLFSPL AYTKTFSMAG       480
     AALLSVTLVP VLMMLFIRGK IMPEAKNPVN RFLIWVYRPI IAGIMRWKKT TIVAAVVALV       540
     ASIYPASQLG SEFMPTLNEG SLLYMPASLP GMSITKAAEL LQTQNKIIKS FPEVTSVYGK       600
     AGRANTATDP APTEMFETVI NLKPESEWRP GLTTDKLIAE LDKALQFPGV ANSWTMPIKA       660
     RIDMLSTGIR TPIGIKVFGK DLGEMEKVAR EIEAVVKAVP GTTSAYAERI TGGFYLNIEP       720
     DREQLARYGL AVGDLQDVIG TALGGEMVTT TVEGRERFGV SVRYPRELRS DPQQIAREVL       780
     IPTMDGAMIP LGQLARVGVA KGAPSIRTEN ALLSAYIFVD IRDRDIGSYV ADAKKAVAEQ       840
     VSFPPGYYVT WSGQFEYMER AIEKMKIVIP VTLLSIFLLL YLNFKRLTET LIVMLSVPFA       900
     LVGGVWLMWW LGYNLSVAVA VGFIALAGVA AETGVIMLIY LDHAWEALKA KRRTDNQAPT       960
     LHDLYEAIME GAVERVRPKM MTVVAIMAGL LPIMWGTGTG SEVMSRIAAP MVGGMISSTV      1020
     LTLAVIPAIY ALVKQWRIKR GMEQ                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page