(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE81

ACCPU_3.PE81         Location/Qualifiers
FT   CDS             complement(93556..95184)
FT                   /locus_tag="CAP2UW1_4655"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091586"
FT                   /db_xref="GeneID:8402021"
FT                   /translation="MNKGAGLTVGVIAVAMAAGSGYWLGGRGDASHGDAASVASASAEP
FT                   AKKEKKLLFYRNPMGLPDTSPVPKKDPMGMDYIAVYEGEQDDEPASANQIKISTEKVQK
FT                   LGVRTEAAQLRVLDKVVRAAGRIEPDERRIYAISPKFEGYVERLHVNVTGQPVGKGQPL
FT                   FEVYSPELVSAQREYAIAAQGVESLKEADGPARDGMKQLADSSLLRLKNWDISEEQVKA
FT                   LAKSGEARRTLTFRSPVSGIVTEKKALQGMRFMPGEALYQVADLSAVWVVADVFEQDIG
FT                   QVRTGAKAKVRINAYPDKTFEGTISYVYPTLNAQTRTVPVRVELANPGLLLKPSMFAQV
FT                   ELPVGAKGQVVTLPTSAVIDSGARQIVLIQQGEGRFEPREIKLGGRSDNHVEVLEGVKD
FT                   GEQVVVAANFLIDAESNLKAAVGGFGHAAHGAAPTDGKPAVPGQAAAKGSSHQAEGTVD
FT                   GIDAAAGTISLNHGPVASLKWPTMTMEFKAANASLLQGLKPGAKVAVEFVERQPGEWVI
FT                   TAVKPLPANQGAGTPAVGANPHAGH"
FT                   /protein_id="YP_003165229.1"
     MNKGAGLTVG VIAVAMAAGS GYWLGGRGDA SHGDAASVAS ASAEPAKKEK KLLFYRNPMG        60
     LPDTSPVPKK DPMGMDYIAV YEGEQDDEPA SANQIKISTE KVQKLGVRTE AAQLRVLDKV       120
     VRAAGRIEPD ERRIYAISPK FEGYVERLHV NVTGQPVGKG QPLFEVYSPE LVSAQREYAI       180
     AAQGVESLKE ADGPARDGMK QLADSSLLRL KNWDISEEQV KALAKSGEAR RTLTFRSPVS       240
     GIVTEKKALQ GMRFMPGEAL YQVADLSAVW VVADVFEQDI GQVRTGAKAK VRINAYPDKT       300
     FEGTISYVYP TLNAQTRTVP VRVELANPGL LLKPSMFAQV ELPVGAKGQV VTLPTSAVID       360
     SGARQIVLIQ QGEGRFEPRE IKLGGRSDNH VEVLEGVKDG EQVVVAANFL IDAESNLKAA       420
     VGGFGHAAHG AAPTDGKPAV PGQAAAKGSS HQAEGTVDGI DAAAGTISLN HGPVASLKWP       480
     TMTMEFKAAN ASLLQGLKPG AKVAVEFVER QPGEWVITAV KPLPANQGAG TPAVGANPHA       540
     GH                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page