(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE82

ACCPU_3.PE82         Location/Qualifiers
FT   CDS             complement(95181..96452)
FT                   /locus_tag="CAP2UW1_4656"
FT                   /gene_family="HOG000220103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091587"
FT                   /db_xref="GeneID:8402022"
FT                   /translation="MRRLRPLSILILALATASGAPVLAQEAALGANVDTLINYAKTRNP
FT                   EYAAMQAEAEASGERVTPAGALPDPKFRTELRDITRMGEQSATLSPSRVGSTRYLLMQD
FT                   IPWFGKRDLKREIAELEADGAKGRALGTWADVAGRIKVNFAQLYYVHRNEQLTREILDL
FT                   MTRLEKVAQVRYSGGLAAQQDVIRAQVEQTNMRNELIALETEQHHLHARLNALLARPNN
FT                   APLQVPTQLRKLPAPVTLDYATLEERVRTRNPQLFADESKIKAAEKSRDLTYKNRYPDF
FT                   TLGVSPIQYQNSIKEWELMFEVNIPLQQSSRRSQERESESMLNAARSRKEATTNQVSAE
FT                   LAEALSGIEAARRTENLLTNSLLPQAELTFKAALAGYETGKVDFATLLDSQRQIRQARQ
FT                   DQLKAQVDAQMRLAEIERLLGEDL"
FT                   /protein_id="YP_003165230.1"
     MRRLRPLSIL ILALATASGA PVLAQEAALG ANVDTLINYA KTRNPEYAAM QAEAEASGER        60
     VTPAGALPDP KFRTELRDIT RMGEQSATLS PSRVGSTRYL LMQDIPWFGK RDLKREIAEL       120
     EADGAKGRAL GTWADVAGRI KVNFAQLYYV HRNEQLTREI LDLMTRLEKV AQVRYSGGLA       180
     AQQDVIRAQV EQTNMRNELI ALETEQHHLH ARLNALLARP NNAPLQVPTQ LRKLPAPVTL       240
     DYATLEERVR TRNPQLFADE SKIKAAEKSR DLTYKNRYPD FTLGVSPIQY QNSIKEWELM       300
     FEVNIPLQQS SRRSQERESE SMLNAARSRK EATTNQVSAE LAEALSGIEA ARRTENLLTN       360
     SLLPQAELTF KAALAGYETG KVDFATLLDS QRQIRQARQD QLKAQVDAQM RLAEIERLLG       420
     EDL                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page