(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE83

ACCPU_3.PE83         Location/Qualifiers
FT   CDS             complement(96531..96875)
FT                   /locus_tag="CAP2UW1_4657"
FT                   /gene_family="HOG000126315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091588"
FT                   /db_xref="GeneID:8402023"
FT                   /translation="MKTLITASLMAIASLGAVSVQAAGNHAGHAMAAPAAASAEMQMVD
FT                   GQVKKVDKAAGKVTLSHGPLTNLNMPAMTMVFKVSNAAWLDQMKSGDKIRFMADTVKGA
FT                   ITVVHFEPTK"
FT                   /protein_id="YP_003165231.1"
     MKTLITASLM AIASLGAVSV QAAGNHAGHA MAAPAAASAE MQMVDGQVKK VDKAAGKVTL        60
     SHGPLTNLNM PAMTMVFKVS NAAWLDQMKS GDKIRFMADT VKGAITVVHF EPTK             114
//

If you have problems or comments...

PBIL Back to PBIL home page