(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE84

ACCPU_3.PE84         Location/Qualifiers
FT   CDS             complement(96894..97334)
FT                   /locus_tag="CAP2UW1_4658"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091589"
FT                   /db_xref="GeneID:8402024"
FT                   /translation="MRNHVLVLALITAFGAGLSSVATAGEMVDVYKNPNCDCCGKWIDH
FT                   LKDAGFEVRAHNVMDVPATRKRLGMPDRLGSCHTAKVAGYVVEGHVPAGDIQRLLKEKP
FT                   KALGIAVPSMPPGSPGMESSKPVPYNTLLVQSGGEASIFAKH"
FT                   /protein_id="YP_003165232.1"
     MRNHVLVLAL ITAFGAGLSS VATAGEMVDV YKNPNCDCCG KWIDHLKDAG FEVRAHNVMD        60
     VPATRKRLGM PDRLGSCHTA KVAGYVVEGH VPAGDIQRLL KEKPKALGIA VPSMPPGSPG       120
     MESSKPVPYN TLLVQSGGEA SIFAKH                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page