(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE86

ACCPU_3.PE86         Location/Qualifiers
FT   CDS             97858..98391
FT                   /locus_tag="CAP2UW1_4660"
FT                   /gene_family="HOG000158229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091591"
FT                   /db_xref="GeneID:8402026"
FT                   /translation="MQRIVAGISTLEQHLETVKGKREVYRPPSCPHCGIKLLCQHGYYY
FT                   RKADRRVQRPSLNPVPICRYRCGGCRRTCSRLPECIAPRRWYDWSVQQNALSARLDGRP
FT                   VGGGGDDGQPAVRSTGRWWAWLQARGPIFAFSLRCRFRELGRASDFTGFWRQVFATLGL
FT                   PRAMAWLDREMSVP"
FT                   /protein_id="YP_003165234.1"
     MQRIVAGIST LEQHLETVKG KREVYRPPSC PHCGIKLLCQ HGYYYRKADR RVQRPSLNPV        60
     PICRYRCGGC RRTCSRLPEC IAPRRWYDWS VQQNALSARL DGRPVGGGGD DGQPAVRSTG       120
     RWWAWLQARG PIFAFSLRCR FRELGRASDF TGFWRQVFAT LGLPRAMAWL DREMSVP          177
//

If you have problems or comments...

PBIL Back to PBIL home page