(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE87

ACCPU_3.PE87         Location/Qualifiers
FT   CDS             98521..99846
FT                   /locus_tag="CAP2UW1_4661"
FT                   /gene_family="HOG000220570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091592"
FT                   /db_xref="GeneID:8402027"
FT                   /translation="MNEIDPQALFRFSVLGPLISRQRLARGELQKSLRELATREYVIPG
FT                   TDRRLLGEKTIEGWYYRYRARGLDGLIPKVRADRGQSKLSASVQAAILAAKRENPRRSI
FT                   RQIQRVLEIGGIVARGTLSRSSLHRLLQQHGLSRLPGSASLPEEKRSFVAACAGELWYS
FT                   DVMHGPRVPIGGRLGKSYLVSLFDDASRLVAHGAFCRGETALDIEGVLKQALLKRGVPV
FT                   KLVVDNGAAYVAQTLQGICARLGIVLVHCRPYAPESKGKIERWHRTCRDQFLSEVEERH
FT                   VLSLDDLNARLWAWLEQVYHRTPHDGLEGQTPLARYQQDLPKIRLLGPLAATLDTLFLH
FT                   RVRRLVRKDGTVSYQGGRFEVPFELTGKTVCLRVDPHTETVVGVENDAGELIGRATPLD
FT                   ALANRDRRRRQPDPVAAVPVKRPAGPNLVELVYEQYYGRQGD"
FT                   /protein_id="YP_003165235.1"
     MNEIDPQALF RFSVLGPLIS RQRLARGELQ KSLRELATRE YVIPGTDRRL LGEKTIEGWY        60
     YRYRARGLDG LIPKVRADRG QSKLSASVQA AILAAKRENP RRSIRQIQRV LEIGGIVARG       120
     TLSRSSLHRL LQQHGLSRLP GSASLPEEKR SFVAACAGEL WYSDVMHGPR VPIGGRLGKS       180
     YLVSLFDDAS RLVAHGAFCR GETALDIEGV LKQALLKRGV PVKLVVDNGA AYVAQTLQGI       240
     CARLGIVLVH CRPYAPESKG KIERWHRTCR DQFLSEVEER HVLSLDDLNA RLWAWLEQVY       300
     HRTPHDGLEG QTPLARYQQD LPKIRLLGPL AATLDTLFLH RVRRLVRKDG TVSYQGGRFE       360
     VPFELTGKTV CLRVDPHTET VVGVENDAGE LIGRATPLDA LANRDRRRRQ PDPVAAVPVK       420
     RPAGPNLVEL VYEQYYGRQG D                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page