(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE88

ACCPU_3.PE88         Location/Qualifiers
FT   CDS             99849..100643
FT                   /locus_tag="CAP2UW1_4662"
FT                   /gene_family="HOG000158228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091593"
FT                   /db_xref="GeneID:8402028"
FT                   /translation="MELQHFGLRHSPLGKETRELWDDGMLTRLRERFQWLLQSPGIGLL
FT                   TGEAGVGKTAALRAVTATLNPHRYQVIYHAETDFGRLDLYRCLAQSLGLAPSYRRALLW
FT                   REIKAHIHHLADGKQLLPVWILDEAQNLPPDFFRDFPAFLNFAFDSRDLMSVWLVGHPV
FT                   LAQTLQRAPYAALAGRIQARVHLTPVFERERFARLIEHGLKSAGNSSTLLTDSGMEILR
FT                   QASKGLPRNAARILRTAMRLALPRGLNHLPDELLQLAIEELR"
FT                   /protein_id="YP_003165236.1"
     MELQHFGLRH SPLGKETREL WDDGMLTRLR ERFQWLLQSP GIGLLTGEAG VGKTAALRAV        60
     TATLNPHRYQ VIYHAETDFG RLDLYRCLAQ SLGLAPSYRR ALLWREIKAH IHHLADGKQL       120
     LPVWILDEAQ NLPPDFFRDF PAFLNFAFDS RDLMSVWLVG HPVLAQTLQR APYAALAGRI       180
     QARVHLTPVF ERERFARLIE HGLKSAGNSS TLLTDSGMEI LRQASKGLPR NAARILRTAM       240
     RLALPRGLNH LPDELLQLAI EELR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page