(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE89

ACCPU_3.PE89         Location/Qualifiers
FT   CDS             100640..100843
FT                   /locus_tag="CAP2UW1_4663"
FT                   /gene_family="HOG000158227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091594"
FT                   /db_xref="GeneID:8402029"
FT                   /translation="MSRRRHAGFPEGLSDEAAAALCDFLFQLATACESHYLVQLRRHHD
FT                   RQRNLYDPEDPWRFPPNAPRSR"
FT                   /protein_id="YP_003165237.1"
     MSRRRHAGFP EGLSDEAAAA LCDFLFQLAT ACESHYLVQL RRHHDRQRNL YDPEDPWRFP        60
     PNAPRSR                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page