(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE9

ACCPU_3.PE9          Location/Qualifiers
FT   CDS             complement(8784..9083)
FT                   /locus_tag="CAP2UW1_4576"
FT                   /gene_family="HOG000118706" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091514"
FT                   /db_xref="GeneID:8401949"
FT                   /translation="MQTSDPVTDDKTRAARLEARLSVEQKAVLQQAATLSGRTLSEFVV
FT                   ASAQEAAARILREHETIRLSRAEQIAFVTALLDPPAPNERLRQAAAAYRQQMGR"
FT                   /protein_id="YP_003165157.1"
     MQTSDPVTDD KTRAARLEAR LSVEQKAVLQ QAATLSGRTL SEFVVASAQE AAARILREHE        60
     TIRLSRAEQI AFVTALLDPP APNERLRQAA AAYRQQMGR                               99
//

If you have problems or comments...

PBIL Back to PBIL home page