(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE92

ACCPU_3.PE92         Location/Qualifiers
FT   CDS             102678..102965
FT                   /locus_tag="CAP2UW1_4666"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091597"
FT                   /db_xref="GeneID:8402032"
FT                   /translation="MMKKMLMVALMSAVSVTAFASDAARAAAKQVIELKDGSTVYIFKD
FT                   GKMGMEDKLGRSIRMKKDTVMETKDGQKIIMHGDEVMRLDNLLKEGHTGG"
FT                   /protein_id="YP_003165240.1"
     MMKKMLMVAL MSAVSVTAFA SDAARAAAKQ VIELKDGSTV YIFKDGKMGM EDKLGRSIRM        60
     KKDTVMETKD GQKIIMHGDE VMRLDNLLKE GHTGG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page