(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE94

ACCPU_3.PE94         Location/Qualifiers
FT   CDS             complement(103253..104836)
FT                   /locus_tag="CAP2UW1_4668"
FT                   /gene_family="HOG000004065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091599"
FT                   /db_xref="GeneID:8402034"
FT                   /translation="MHLSKHDLFQMNDEWLKKLPAELLLEVSKRLLHDVKELQDRLNQN
FT                   PDNSSRPPTSQPPWAKTGGSEEQNGAADERGNADVAAETAGSSTEETEQAPPVDGQRQS
FT                   AKKGSGKRPGKQPGSPGHGRSQKLAITARCEHRPEICAACAAVLSADAASQAYTAWDEV
FT                   DIAPPVESLIGLTFSVTRHTLLEVSCSCGHVSRAQAWRAPADGQWEKVELGEWRLVGPR
FT                   LAGVIVLLAVRMRLSRASIRELLMELFDLTLSTGVIDETIREAGRASLPLEDALVADIV
FT                   QAAQLHVDETSWPESGTLLWLWALVTTHTVLFLIGPRSREMLENALQDGFAGLLISDGY
FT                   GVYRAWANRLRCWPHLLRKLRGLAESSDARVSGVGQEMEGIMKTLMAAIYAARIDPPPE
FT                   GLPARYANEIERLRHLCEAHRMDDHSVLRSVVREFLYDWDVILRPVAEPHLPLSNNAAE
FT                   QALRHWVISRTISHGTRSEEGSRAFAFLASLIETCRRRGASAWQYLGTVIAAARKGLQL
FT                   PTIPAIPATA"
FT                   /protein_id="YP_003165242.1"
     MHLSKHDLFQ MNDEWLKKLP AELLLEVSKR LLHDVKELQD RLNQNPDNSS RPPTSQPPWA        60
     KTGGSEEQNG AADERGNADV AAETAGSSTE ETEQAPPVDG QRQSAKKGSG KRPGKQPGSP       120
     GHGRSQKLAI TARCEHRPEI CAACAAVLSA DAASQAYTAW DEVDIAPPVE SLIGLTFSVT       180
     RHTLLEVSCS CGHVSRAQAW RAPADGQWEK VELGEWRLVG PRLAGVIVLL AVRMRLSRAS       240
     IRELLMELFD LTLSTGVIDE TIREAGRASL PLEDALVADI VQAAQLHVDE TSWPESGTLL       300
     WLWALVTTHT VLFLIGPRSR EMLENALQDG FAGLLISDGY GVYRAWANRL RCWPHLLRKL       360
     RGLAESSDAR VSGVGQEMEG IMKTLMAAIY AARIDPPPEG LPARYANEIE RLRHLCEAHR       420
     MDDHSVLRSV VREFLYDWDV ILRPVAEPHL PLSNNAAEQA LRHWVISRTI SHGTRSEEGS       480
     RAFAFLASLI ETCRRRGASA WQYLGTVIAA ARKGLQLPTI PAIPATA                     527
//

If you have problems or comments...

PBIL Back to PBIL home page