(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE95

ACCPU_3.PE95         Location/Qualifiers
FT   CDS             104919..105173
FT                   /locus_tag="CAP2UW1_4669"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091600"
FT                   /db_xref="GeneID:8402035"
FT                   /translation="MNDYVSAVVSERLASRGHATVSARVDRRREATLNFAIGAAVAQRR
FT                   GIVPGASVPLRLQKPAIRLLPGDVAIAGQAGTSGKGQSP"
FT                   /protein_id="YP_003165243.1"
     MNDYVSAVVS ERLASRGHAT VSARVDRRRE ATLNFAIGAA VAQRRGIVPG ASVPLRLQKP        60
     AIRLLPGDVA IAGQAGTSGK GQSP                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page