(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE97

ACCPU_3.PE97         Location/Qualifiers
FT   CDS             105944..107302
FT                   /locus_tag="CAP2UW1_4671"
FT                   /gene_family="HOG000013931" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091602"
FT                   /db_xref="GeneID:8402037"
FT                   /translation="MSHFIVTDRKTDYLLPPSLDDWLNQDHLARFIVEVVDQLDLSKLT
FT                   RQYAGRGSKAYHPATLLAILVYGYATGIFSSRRLERATYDSVAFRYIAAGSHPDHDSLA
FT                   TFRRRFLDELSDLFLQVLAMAKEMKLLKLGNVCLDGTKIDANASRHSALSHGHIEKLEA
FT                   QLKAEVQELFSLAEQADQADVPDGVSLPEEIKRREDRLAAMAVAKAKIAARAEERYQRE
FT                   KADYDEKMARRAAKEEAAGKKLGGKPPKAPEPGARDSDQINLTDEESRIMPVAGGGFEQ
FT                   AYNAQAGVDAATMLVVAVGVTQAPNDKEQVEPMLATLKAQAEVLGPVESLIADSGFCSE
FT                   KNIKACEAASIDPVIAVARDEHHPDWRERHSEPAPLPENATPVQALSHRLKTKAGRALY
FT                   ALRKQTVEPVFGIIKSVMGFRQFSLRGLKKVTGEWTLVCLAWNLKRMAKLRPQ"
FT                   /protein_id="YP_003165245.1"
     MSHFIVTDRK TDYLLPPSLD DWLNQDHLAR FIVEVVDQLD LSKLTRQYAG RGSKAYHPAT        60
     LLAILVYGYA TGIFSSRRLE RATYDSVAFR YIAAGSHPDH DSLATFRRRF LDELSDLFLQ       120
     VLAMAKEMKL LKLGNVCLDG TKIDANASRH SALSHGHIEK LEAQLKAEVQ ELFSLAEQAD       180
     QADVPDGVSL PEEIKRREDR LAAMAVAKAK IAARAEERYQ REKADYDEKM ARRAAKEEAA       240
     GKKLGGKPPK APEPGARDSD QINLTDEESR IMPVAGGGFE QAYNAQAGVD AATMLVVAVG       300
     VTQAPNDKEQ VEPMLATLKA QAEVLGPVES LIADSGFCSE KNIKACEAAS IDPVIAVARD       360
     EHHPDWRERH SEPAPLPENA TPVQALSHRL KTKAGRALYA LRKQTVEPVF GIIKSVMGFR       420
     QFSLRGLKKV TGEWTLVCLA WNLKRMAKLR PQ                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page